Accéder au contenu
Merck
Toutes les photos(1)

Key Documents

AV34910

Sigma-Aldrich

Anti-CHRNA1 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Cholinergic receptor, nicotinic, α-1 (muscle)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

52 kDa

Espèces réactives

human, guinea pig, bovine, horse, mouse, dog, rat, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CHRNA1(1134)

Description générale

CHRNA1 encodes the α subunit of the muscle acetylcholine receptor and is involved in acetyl choline binding and channel gating functions. The expression of CHRNA1 in thymus tissues is controlled by IRF8 and AIRE.
Rabbit Anti-CHRNA1 recognizes mouse, bovine, canine, and human CHRNA1.

Immunogène

Synthetic peptide directed towards the N terminal region of human CHRNA1

Application

Rabbit Anti-CHRNA1 is suitable for western blot applications at a concentration of 0.5 μg/ml.

Actions biochimiques/physiologiques

The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 The CHRNA1 gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.

Séquence

Synthetic peptide located within the following region: AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Matthieu Giraud et al.
Nature, 448(7156), 934-937 (2007-08-10)
Promiscuous expression of tissue-restricted auto-antigens in the thymus imposes T-cell tolerance and provides protection from autoimmune diseases. Promiscuous expression of a set of self-antigens occurs in medullary thymic epithelial cells and is partly controlled by the autoimmune regulator (AIRE), a

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique