WH0009852M1

Monoclonal Anti-EPM2AIP1 antibody produced in mouse

clone 3H7, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-EPM2A (laforin) interacting protein 1, Anti-FLJ11207, Anti-KIAA0766
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3H7, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: mouse, human, rat
• Methode(n): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2bκ
• GenBank-Hinterlegungsnummer: NM_014805
• UniProt-Hinterlegungsnummer: Q7L775
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... EPM2AIP1(9852)

Beschreibung

Allgemeine Beschreibung

The EPM2A gene, which encodes laforin, is mutated in an autosomal recessive form of adolescent progressive myoclonus epilepsy. The protein encoded by this gene binds to laforin, but its function is not known. This gene is intronless. (provided by RefSeq)

Immunogen

EPM2AIP1 (NP_055620, 508 a.a. ~ 606 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKAFSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESN

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)