SAB2108124

Anti-EXT2 antibody produced in rabbit

affinity isolated antibody

• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 82kDa
• Speziesreaktivität: rabbit, human, mouse, dog, horse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunoblotting: suitable; immunohistochemistry: suitable
• NCBI-Hinterlegungsnummer: NM_000401
• UniProt-Hinterlegungsnummer: Q93063
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... EXT2(2132)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human EXT2

Biochem./physiol. Wirkung

EXT2 is one of two glycosyltransferases involved in the chain elongation step of heparan sulfate biosynthesis.This gene encodes one of two glycosyltransferases involved in the chain elongation step of heparan sulfate biosynthesis. Mutations in this gene cause the type II form of multiple exostoses. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Sequenz

Synthetic peptide located within the following region: NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable