SAB1401762

Monoclonal Anti-IFT122 antibody produced in mouse

clone 3E11, purified immunoglobulin, buffered aqueous solution

• Synonym(e): SPG, WDR10, WDR10p, WDR140
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3E11, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): capture ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1κ
• NCBI-Hinterlegungsnummer: NM_052985
• UniProt-Hinterlegungsnummer: Q9HBG6
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... IFT122(55764)

Beschreibung

Allgemeine Beschreibung

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

Immunogen

IFT122 (NP_443711, 1194 a.a. ~ 1291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCRRCKDDPG

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable