HPA019647

Anti-TRIM35 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Hemopoietic lineage switch protein 5, Anti-Tripartite motif-containing protein 35
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA019647
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: recombinant expression; Learn more about Antibody Enhanced Validation
• Methode(n): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: AKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIERLQMEMKEDDVSFLM
• UniProt-Hinterlegungsnummer: Q9UPQ4
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TRIM35(23087)

Beschreibung

Allgemeine Beschreibung

TRIM35 (Tripartite motif containing 35) is RING domain containing protein belonging to the RING-B-Box-Coiled Coil (RBCC) family. In addition to RING domain, it is composed of one or two B-Box domains and a coiled-coil domain.

Immunogen

Tripartite motif-containing protein 35 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

TRIM35 (Tripartite motif containing 35) is a novel tumor suppressor gene in hepatocellular carcinoma (HCC). It restricts aerobic glycolysis of cancer cells by blocking phosphorylation of pyruvate kinase isoform M2 (PKM2) at the tyrosine residue 105 (Y105). PKM2 plays a key role in the metabolic reprogramming during cancer progression. It has been reported that PKM2 (+) and TRIM35 (-), together perform in the aggressiveness and poor prognosis of HCC and can be a prognostic biomarker and a therapeutic target for HCC. TRIM35 is also involved in the negative regulation of Toll-like receptor 7 (TLR7) and TLR9-mediated type I IFN production via suppressing stability signals of IRF7 (Interferon regulatory factor 7).

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST74255

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable