HPA009650

Anti-ANXA6 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-67 kDa calelectrin antibody produced in rabbit, Anti-Annexin A6 antibody produced in rabbit, Anti-Annexin VI antibody produced in rabbit, Anti-CPB-II antibody produced in rabbit, Anti-Calphobindin-II antibody produced in rabbit, Anti-Chromobindin-20 antibody produced in rabbit, Anti-Lipocortin VI antibody produced in rabbit, Anti-P68 antibody produced in rabbit, Anti-P70 antibody produced in rabbit, Anti-Protein III antibody produced in rabbit
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA009650
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: rat, mouse, human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED
• UniProt-Hinterlegungsnummer: P08133
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ANXA6(309)

Beschreibung

Allgemeine Beschreibung

ANXA6 (annexin A6) belongs to a family of structurally highly conserved, Ca²⁺-regulated membrane-binding proteins called annexins. All annexin proteins are composed of a conserved Ca²⁺ and phospholipid-binding core and an N-terminal tail, which is different in each annexin. However, unlike other annexins this protein contains eight instead of four annexin repeats.

Immunogen

Annexin A6 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-ANXA6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

ANXA6 (annexin A6) plays an essential role in maintaining cellular homeostasis of cholesterol. It functions as a negative regulator of influenza A virus (IAV) replication. It therefore, has an antiviral activity attributed to its capability to influence cellular cholesterol pool. It interacts with membrane phospholipdis, F-actin and specific extracellular matrix (ECM) components. Thus, it might be involved in rapid plasma membrane reorganization, which results in cell adhesion and motility. The expression of this protein promotes anchorage-independent cell growth and loss of cell-cell or cell-ECM adhesion. Thus, it facilitates breast cancer tumorigenesis. This protein is thought to be involved in the assembly of detergent-resistant membrane microdomains (DRMs) found in Niemann-Pick type C (NPC) disease, as it is found anchored to the cholesterol storage compartment membranes in NPC disease fibroblasts.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST86509

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)