Direkt zum Inhalt
Merck

HPA008038

Sigma-Aldrich

ANTI-CDK12 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-CDC2-related protein kinase 7, Anti-CRKRS, Anti-Cdc2-related kinase, arginine/serine-rich, Anti-Cell division cycle 2-related protein kinase 7, Anti-CrkRS

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.43

Biologische Quelle

rabbit

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Methode(n)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Immunogene Sequenz

GFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAY

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... CRKRS(51755)

Allgemeine Beschreibung

Cyclin-dependent kinase 12 (CDK12) is a member of the cyclin-dependent kinase (CDK) family of serine/threonine protein kinases. It is located at 17q12 on the human chromosome. CDK12 is composed of 21 arginine/serine-rich (RS) motifs, a proline-rich motif in between the RS motif, a central kinase domain and a C-terminal region. CDK12 gene encodes a C-terminal repeat domain (CTD) kinase that contains an arginine/serine-rich (RS) domain (CrkRS). It is a 1490 amino acid long and colocalizes with SC35 speckles.

Immunogen

Cell division cycle 2-related protein kinase 7 recombinant protein epitope signature tag (PrEST)

Anwendung

ANTI-CDK12 antibody produced in rabbit has been used in immunohistochemistry.
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

Cyclin-dependent kinase 12 (CDK-12) interacts with cyclin L1 and cyclin L2 and regulates alternative splicing. This kinase phosphorylates the CTD of the large subunit of RNA polymerase II and regulates transcription elongation. It forms a link between transcription and splicing machinery. It negatively regulates MAPK pathway and has a role in the resistance to estrogen signaling inhibitors during endocrine therapy.
Cyclin-dependent kinase 12 (CDK12) is a transcription-associated CDK. It plays a role in DNA-damage response, splicing and differentiation. Overexpression and mutation of the CDK12 gene is associated with several malignancies.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST71450

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Analysenzertifikate (COA)

Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Goldie Y L Lui et al.
Journal of clinical pathology, 71(11), 957-962 (2018-08-15)
Cyclin-dependent kinase 12 (CDK12) belongs to the cyclin-dependent kinase (CDK) family of serine/threonine protein kinases that regulate transcriptional and post-transcriptional processes, thereby modulating multiple cellular functions. Early studies characterised CDK12 as a transcriptional CDK that complexes with cyclin K to
CrkRS: a novel conserved Cdc2-related protein kinase that colocalises with SC35 speckles
K Tun K, et al.
Journal of Cell Science, 114(14), 2591-2603 (2001)
The emerging roles of CDK12 in tumorigenesis
Paculova H and Kohoutek J
Cell Division, 12(1), 7-7 (2017)
Meijia Liu et al.
Pathology, research and practice, 216(7), 152962-152962 (2020-06-15)
Cyclin-dependent kinase 12 (CDK12) belongs to the cyclin-dependent kinase (CDK) family, modulating multiple cellular functions including DNA damage response (DDR), development and cellular differentiation, transcription, mRNA processing, splicing and pre-mRNA processing. CDK12 has been reported as both tumor suppressor and
Hung-Hsi Chen et al.
Molecular and cellular biology, 26(7), 2736-2745 (2006-03-16)
CrkRS is a Cdc2-related protein kinase that contains an arginine- and serine-rich (SR) domain, a characteristic of the SR protein family of splicing factors, and is proposed to be involved in RNA processing. However, whether it acts together with a

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.