AV48436

Anti-HSPB6 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-FLJ32389, Anti-Heat shock protein, α-crystallin-related, B6, Anti-Hsp20
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 17 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_653218
• UniProt-Hinterlegungsnummer: O14558
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... HSPB6(126393)

Beschreibung

Allgemeine Beschreibung

HSPB6 (Hsp20) encodes a heat shock protein that may be involved in the relaxation of smooth muscles. It is known to interact with Bag3. HSPB6 has also been implicated in platelet aggregation, atherosclerosis, myocardial infarction, insulin resistance and Alzheimer′s disease.
Rabbit Anti-HSPB6 antibody recognizes canine, bovine, human, mouse, rat, chicken, and pig HSPB6.

Immunogen

Synthetic peptide directed towards the middle region of human HSPB6

Anwendung

Rabbit Anti-HSPB6 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.

Biochem./physiol. Wirkung

HSPB6 is associated with actin and modulates smooth muscle relaxation.HSPB6 is associated with actin (see MIM 102540) and modulates smooth muscle relaxation (Tessier et al., 2003 [PubMed 12842460]).[supplied by OMIM].

Sequenz

Synthetic peptide located within the following region: ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable