AV44249
Anti-PTCH1 antibody produced in rabbit
affinity isolated antibody
Synonym(e):
Anti-Patched homolog 1 (Drosophila)
Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise
Alle Fotos(3)
About This Item
UNSPSC-Code:
12352203
NACRES:
NA.41
Empfohlene Produkte
Biologische Quelle
rabbit
Qualitätsniveau
Konjugat
unconjugated
Antikörperform
affinity isolated antibody
Antikörper-Produkttyp
primary antibodies
Klon
polyclonal
Form
buffered aqueous solution
Mol-Gew.
37 kDa
Speziesreaktivität
dog, bovine, horse, human, mouse, guinea pig, rat
Konzentration
0.5 mg - 1 mg/mL
Methode(n)
immunohistochemistry: suitable
western blot: suitable
NCBI-Hinterlegungsnummer
UniProt-Hinterlegungsnummer
Versandbedingung
wet ice
Lagertemp.
−20°C
Posttranslationale Modifikation Target
unmodified
Angaben zum Gen
human ... PTCH1(5727)
Allgemeine Beschreibung
Protein patched homolog 1 (PTCH1) is the receptor for secreted sonic hedgehog ligand and belongs to the patched gene family. It is mapped to human chromosome 9q22.32. Ptch1 has 12 transmembrane regions, intracellular middle-loop domain (MLD) and C-terminal domain (CTD) essential for oligomerization.
Immunogen
Synthetic peptide directed towards the C terminal region of human PTCH1
Anwendung
Anti-PTCH1 antibody produced in rabbit has been used in Flow cytometry/Cell sorting. It is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Flow cytometry/Cell sorting (1 paper)
Flow cytometry/Cell sorting (1 paper)
Biochem./physiol. Wirkung
Mutations in protein patched homolog 1(PTCH1) is implicated in autosomal dominant disorder called the Gorlin syndrome, resulting in developmental abnormalities.
PTCH1 (patched 1; PTC) activates the sonic hedgehog (Hh) signaling pathway that is involved in the development of embryonic structures. PTCH1 is a tumor suppressor that maintains the activity of GLI1, the downstream target of Hh signaling. Mutations and methylation status in PTCH1 gene result in tumorigenesis and malignancy in cancers including colorectal, gastric, melanoma and osteosarcoma.
Sequenz
Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM
Physikalische Form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Haftungsausschluss
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Sie haben nicht das passende Produkt gefunden?
Probieren Sie unser Produkt-Auswahlhilfe. aus.
Lagerklassenschlüssel
10 - Combustible liquids
WGK
WGK 3
Flammpunkt (°F)
Not applicable
Flammpunkt (°C)
Not applicable
Analysenzertifikate (COA)
Suchen Sie nach Analysenzertifikate (COA), indem Sie die Lot-/Chargennummer des Produkts eingeben. Lot- und Chargennummern sind auf dem Produktetikett hinter den Wörtern ‘Lot’ oder ‘Batch’ (Lot oder Charge) zu finden.
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Swan Hwang et al.
PloS one, 8(7), e68271-e68271 (2013-08-13)
The sonic hedgehog (Shh) signaling pathway is necessary for a variety of development and differentiation during embryogenesis as well as maintenance and renascence of diverse adult tissues. However, an abnormal activation of the signaling pathway is related to various cancers.
Gorlin syndrome patient with large deletion in 9q22. 32-q22. 33 detected by quantitative multiplex fluorescent PCR
Musani V, et al.
Dermatology (Basel, Switzerland), 219(2), 111-118 (2009)
Jon H Chung et al.
Oncotarget, 4(12), 2208-2211 (2013-12-26)
Hedgehog (Hh) signaling is largely suppressed in the normal differentiated tissues of the adult but activated in many cancers. The Hh pathway can either be activated by the expression of Hh ligands, or by mutations that cause constitutive, ligand-independent signaling.
The protein-specific activities of the transmembrane modules of Ptch1 and Ptch2 are determined by their adjacent protein domains
Fleet AJ and Hamel PA
The Journal of Biological Chemistry, 293(43), 16583-16595 (2018)
Winnie W Lo et al.
Sarcoma, 2014, 261804-261804 (2014-05-07)
Despite the importance of Hedgehog signaling in bone development, the relationship between Hedgehog pathway expression and osteosarcoma clinical characteristics and outcome has not been investigated. In this study of 43 high-grade human osteosarcoma samples, we detected high expression levels of
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung.