AV34981

Anti-GABRA3 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-γ-Aminobutyric acid (GABA) A receptor, α 3
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 55 kDa
• Speziesreaktivität: mouse, guinea pig, horse, human, rabbit, dog, rat, bovine
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_000799
• UniProt-Hinterlegungsnummer: P34903
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... GABRA3(2556)

Beschreibung

Allgemeine Beschreibung

GABRA3 codes for the GABA_A receptor α3 subunit. Genetic varaiations in GABRA3 have been linked to behavioural despair, bipolar affective disorders and thyrotoxic hypokalaemic periodic paralysis.
Rabbit Anti-GABRA3 antibody recognizes bovine, human, mouse, rat, and canine GABRA3.

Immunogen

Synthetic peptide directed towards the middle region of human GABRA3

Anwendung

Rabbit Anti-GABRA3 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.

Biochem./physiol. Wirkung

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Sequenz

Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable