AV32715

Anti-NFATC4 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 95 kDa
• Speziesreaktivität: horse, rat, dog, rabbit, guinea pig, human, bovine, mouse
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_001129494
• UniProt-Hinterlegungsnummer: Q14934
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NFATC4(4776)

Beschreibung

Allgemeine Beschreibung

NFATC4 forms a part of a DNA-binding transcription complex that consists of inducible cytosolic and nuclear components. NFATC4 is involved in modulating neurotrophin-mediated synaptic plasticity and can also induce interleukins 2 and 4. p38 Mitogen-activated protein (MAP) kinases can regulate NFATC4 phosphorylation.
Rabbit Anti-NFATC4 antibody recognizes canine, bovine, human, mouse, and rat NFATC4.

Immunogen

Synthetic peptide directed towards the middle region of human NFATC4

Anwendung

Rabbit Anti-NFATC4 antibody can be used for western blot (1.25μg/ml) and IHC (4-8μg/ml) applications.

Biochem./physiol. Wirkung

NFATC4 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. NFATC4 plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.

Sequenz

Synthetic peptide located within the following region: GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable