AV100692

Anti-TCEB3 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-Transcription elongation factor B (SIII), polypeptide 3 (110 kDa, elongin A)
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 87 kDa
• Speziesreaktivität: human, dog
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_003189
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TCEB3(6924)

Beschreibung

Immunogen

Synthetic peptide directed towards the C terminal region of human TCEB3

Anwendung

Anti-TCEB3 antibody produced in rabbit is suitable for western blotting at a working concentration of 7.5 μg/ml. The recommended concentration for immunohistochemistry of paraffin-embedded tissue sections is 4-8 μg/ml.

Biochem./physiol. Wirkung

Transcription elongation factor b mediates crosstalk between RNA processing factors, transcription apparatus and the chromatin. This crosstalk results in transcription elongation and optimum production of mRNA.

Sequenz

Synthetic peptide located within the following region: AYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPMMAKTIKAFKNRFSRR

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable