613571

TIRAP Inhibitor Peptide, Control, Cell-Permeable

The TIRAP Inhibitor Peptide, Control, Cell-Permeable serves as a control for TIRAP Inhibitor Peptide. This small molecule/inhibitor is primarily used for Inflammation/Immunology applications.

• Synonym(e): TIRAP Inhibitor Peptide, Control, Cell-Permeable, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, Ant-Tirap _151-138, TIRAP Peptide, Control, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL), Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, Ant-Tirap_151-138, TIRAP Peptide, Control, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
• Empirische Formel (Hill-System): C₁₆₃H₂₆₈N₅₂O₃₈S
• Molekulargewicht: 3596.26
• UNSPSC-Code: 12352202

Eigenschaften

• Qualitätsniveau: 100
• Assay: ≥97% (HPLC)
• Form: lyophilized solid
• Hersteller/Markenname: Calbiochem^®
• Lagerbedingungen: OK to freeze; desiccated (hygroscopic); protect from light
• Farbe: white
• Löslichkeit: DMSO: 5 mg/mL
• Versandbedingung: wet ice
• Lagertemp.: −20°C

Beschreibung

Allgemeine Beschreibung

A cell-permeable synthetic peptide containing mouse TIRAP_151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).

A cell-permeable synthetic peptide containing mouse toll-interleukin 1 receptor (TIR) domain-containing adapter protein 151-138 reverse sequence (TIRAP; also called Mal (MyD88-adapter-like), fused to the Drosophila antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).

Biochem./physiol. Wirkung

Cell permeable: yes

Primary Target
Control for TIRAP inhibitor

Product does not compete with ATP.

Reversible: no

Verpackung

Packaged under inert gas

Warnhinweis

Toxicity: Standard Handling (A)

Sequenz

H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH

Physikalische Form

Supplied as a trifluoroacetate salt.

Rekonstituierung

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Sonstige Hinweise

Horng, T., et al. 2001. Nat. Immunol.2, 835.

Rechtliche Hinweise

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 11 - Combustible Solids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable