Skip to Content
Merck
All Photos(3)

Key Documents

AV100880

Sigma-Aldrich

Anti-EGR2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CMT1D, Anti-CMT4E, Anti-DKFZp686J1957, Anti-Early growth response 2 (Krox-20 homolog, Drosophila), Anti-FLJ14547, Anti-KROX20

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

50 kDa

species reactivity

mouse, bovine, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... EGR2(1959)

General description

Early growth response (EGR) proteins are transcriptional regulators (EGR1-4) of gene expression involved in the growth and differentiation of many cells. Early growth response 2 (EGR2, Krox20, CMT1D, CMT4E), a C2H2-type zinc-finger protein, regulates a wide spectrum of cellular responses including differentiation (osteoclast), tissue (brain) patterning, and apoptosis.

Specificity

Rabbit polyclonal anti-EGR2 antibody reacts with zebrafish, canine, human, mouse, rat, and pig early growth response 2 factors.

Immunogen

Synthetic peptide directed towards the C terminal region of human EGR2

Application

Rabbit polyclonal anti-EGR2 antibody is used to tag early growth response 2 factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of early growth response 2 factor in cell processes such as differentiation (osteoclast), tissue (brain) patterning, and apoptosis. Anti-EGR2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Sequence

Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yankel Gabet et al.
Blood, 116(19), 3964-3971 (2010-08-19)
Krox20/EGR2, one of the 4 early growth response genes, is a highly conserved transcription factor implicated in hindbrain development, peripheral nerve myelination, tumor suppression, and monocyte/macrophage cell fate determination. Here, we established a novel role for Krox20 in postnatal skeletal
Charlotte Labalette et al.
Development (Cambridge, England), 138(2), 317-326 (2010-12-24)
Vertebrate hindbrain segmentation is an evolutionarily conserved process that involves a complex interplay of transcription factors and signalling pathways. Fibroblast growth factor (FGF) signalling plays a major role, notably by controlling the expression of the transcription factor Krox20 (Egr2), which
V P Sukhatme
Journal of the American Society of Nephrology : JASN, 1(6), 859-866 (1990-12-01)
How eucaryotic cells respond to growth signals is a topic of considerable interest. Though much attention has focused on second messenger pathways, in recent years, progress has been made on elucidating the transcriptional events that lie more distally in the
Hozo Matsuoka et al.
International journal of molecular sciences, 19(2) (2018-02-09)
Neurotropin® (NTP), a non-protein extract of inflamed rabbit skin inoculated with vaccinia virus, is clinically used for the treatment of neuropathic pain in Japan and China, although its effect on peripheral nerve regeneration remains to be elucidated. The purpose of

Global Trade Item Number

SKUGTIN
AV100880-100UL4061836200039
AV100880-50UG

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service