AV37320
Anti-PYCARD antibody produced in rabbit
IgG fraction of antiserum
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
MDL number:
UNSPSC Code:
12352203
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
21 kDa
species reactivity
human, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
mouse ... PYCARD(66824)
General description
Apoptosis-associated speck-like protein containing a CARD (Pycard) is a member of a superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspases. It is found in the cytoplasm but following apoptosis it is found localized near the nucleus in ball like structures.
Immunogen
Synthetic peptide directed towards the middle region of mouse PYCARD
Application
HS5 myeloid cell lysates were subjected to western blot analysis where blots were probed with rabbit anti-pycard at a 1:1000 dilution.
Biochem/physiol Actions
Pycard is a cytosolic soluble protein that forms insoluble aggregates and enhances etoposide-induced apoptosis.
Sequence
Synthetic peptide located within the following region: TVLRDMGLQELAEQLQTTKEESGAVAAAASVPAQSTARTGHFVDQHRQAL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Masaaki Shiohara et al.
Biochemical and biophysical research communications, 293(5), 1314-1318 (2002-06-11)
ASC is an adaptor protein that is composed of two protein-protein interaction domains, a PYRIN domain (PYD), and a caspase-recruitment domain (CARD). Recently, ASC was identified as a binding partner of pyrin, which is the product of MEFV, a gene
Xiang Li et al.
Blood, 116(13), 2304-2314 (2010-06-22)
Patients with low-grade myelodysplastic syndromes (MDS) show high levels of tumor necrosis factor α (TNFα) and up-regulation of apoptosis in the marrow. In contrast, marrow cells in advanced MDS are typically resistant to TNFα-induced apoptosis but are rendered apoptosis-sensitive on
E Ibrahim et al.
Human reproduction (Oxford, England), 29(11), 2368-2373 (2014-09-11)
Does neutralization of apoptosis-associated speck-like protein containing a caspase activation and recruitment domain (ASC) improve sperm motility in men with spinal cord injury (SCI)? Neutralization of ASC improves sperm motility in men with SCI. Semen of men with SCI contains
J Xu et al.
Cell death and differentiation, 21(8), 1229-1239 (2014-04-29)
Macrophages can be activated and regulated by high-mobility group box 1 (HMGB1), a highly conserved nuclear protein. Inflammatory functions of HMGB1 are mediated by binding to cell surface receptors, including the receptor for advanced glycation end products (RAGE), Toll-like receptor
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service