WH0154214M1

Monoclonal Anti-IBRDC1 antibody produced in mouse

clone 4B1, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-C6orf172, Anti-IBR domain containing 1, Anti-MGC26996, Anti-dJ84N20.1
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4B1, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_152553
• UniProt accession no.: Q8TC41
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RNF217(154214)

Descripción

General description

IBR domain containing 1 (IBRDC1) or ring finger protein 217 is expressed in the skeletal muscle and testis. It is made up of 284 amino acids.

Immunogen

IBRDC1 (NP_689766, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHE

Biochem/physiol Actions

IBR domain containing 1 (IBRDC1) is expressed in leukemia cells. It has been categorized as an E3 ubiquitin-protein ligase.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)