Saltar al contenido
MilliporeSigma
Todas las fotos(8)

Key Documents

WH0010875M1

Sigma-Aldrich

Monoclonal Anti-FGL2 antibody produced in mouse

clone 6D9, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-T49, Anti-fibrinogen-like 2, Anti-pT49

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

6D9, monoclonal

form

buffered aqueous solution

species reactivity

human, mouse, rat

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FGL2(10875)

General description

Fibrinogen-like protein 2 (FGL2) belongs to the fibrinogen-like protein family. The FGL2 gene is located on the human chromosome at 7q11.23.

Immunogen

FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG

Application

Monoclonal Anti-FGL2 antibody produced in mouse has been used in immunohistochemistry.

Biochem/physiol Actions

Fibrinogen-like protein 2 (FGL2) exhibits prothrombinase activity. It also shows immune regulatory activity during allograft rejection, abortion, and viral infections. This protein acts as an immune coagulant that produces thrombin directly. FGL2 through the clotting-dependent pathway may play a role in tumor angiogenesis and metastasis. It is involved in the pathogenesis of T helper type 1 (Th1) cytokine-induced fetal loss syndrome and viral-induced fulminant hepatitis. FGL2 gene is involved in modulating regulatory T cells (Treg) function. This protein regulates innate and adaptive immunity. FGL2 may serve as a therapeutic agent for glioblastoma (GBM) by promoting GBM progression.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Kai Su et al.
World journal of gastroenterology, 14(39), 5980-5989 (2008-10-22)
To examine the role of Fibrinogen-like protein 2 (fgl2)/fibroleukin in tumor development. Fgl2 has been reported to play a vital role in the pathogenesis in MHV-3 (mouse hepatitis virus) induced fulminant and severe hepatitis, spontaneous abortion, allo- and xeno- graft
Liang Shao et al.
Fundamental & clinical pharmacology, 28(1), 42-52 (2012-09-19)
Atorvastatin is not only an antilipemic but also used as an anti-inflammatory medicine in heart disease. Our working hypothesis was that atorvastatin preconditioning could improve the forward blood flow in the no-reflow rats associated with inflammation. We investigated that two
Yu Ding et al.
Chinese journal of integrative medicine, 27(7), 527-533 (2020-01-07)
To investigate the protective effects of Shexiang Tongxin Dropping Pill (, STDP) following sodium laurate-induced coronary microembolization (CME) in rats. Forty rats were divided into 4 groups: the control (sham) group, CME group, low-dose STDP pretreatment group (20 mg·kg-1·d-1), and
Khatri Latha et al.
Journal of the National Cancer Institute, 111(3), 292-300 (2018-06-28)
Virtually all low-grade gliomas (LGGs) will progress to high-grade gliomas (HGGs), including glioblastoma, the most common malignant primary brain tumor in adults. A key regulator of immunosuppression, fibrinogen-like protein 2 (FGL2), may play an important role in the malignant transformation
Itay Shalev et al.
Journal of immunology (Baltimore, Md. : 1950), 180(1), 249-260 (2007-12-22)
Mice with targeted deletion of fibrinogen-like protein 2 (fgl2) spontaneously developed autoimmune glomerulonephritis with increasing age, as did wild-type recipients reconstituted with fgl2-/- bone marrow. These data implicate FGL2 as an important immunoregulatory molecule and led us to identify the

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico