WH0006866M1

Monoclonal Anti-TAC3 antibody produced in mouse

clone 2D7, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-NKB, Anti-NKNB, Anti-PRO1155, Anti-ZNEUROK1, Anti-tachykinin 3 (neuromedin K, neurokinin beta)
• MDL number: MFCD00162715
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2D7, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: BC032145
• UniProt accession no.: Q9UHF0
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TAC3(6866)

Descripción

Immunogen

TAC3 (AAH32145, 17 a.a. ~ 121 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)