WH0002303M2

Monoclonal Anti-FOXC2 antibody produced in mouse

clone 2H3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-FKHL14, Anti-MFH1, Anti-forkhead box C2 (MFH-1, mesenchyme forkhead 1)
• MDL number: MFCD06411812
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2H3, monoclonal
• form: buffered aqueous solution
• species reactivity: mouse, human, rat
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bλ
• GenBank accession no.: NM_005251
• UniProt accession no.: Q99958
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FOXC2(2303)

Descripción

General description

Forkhead Box Protein C2 (FOXC2) is a transcription factor. It belongs to the forkhead/winged-helix family of transcription factors. This gene is located on human chromosome 16q24.

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. (provided by RefSeq)

Immunogen

FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY

Application

Monoclonal Anti-FOXC2 antibody has been used in immunohistochemistry.

Biochem/physiol Actions

Forkhead Box Protein C2 (FOXC2) controls YAP (yes-associated protein) signaling and stimulates the progression of nasopharyngeal carcinoma by promoting glycolysis. It plays a major role in inducing invasion and metastasis. Mutations in FOXC2 result in hereditary Lymphedema-Distichiasis syndrome.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 12 - Non Combustible Liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)