SAB5702880

Anti-MOV10 Antibody, clone 1M7M9, Rabbit Monoclonal

• Sinónimos: fSAP113, gb110
• UNSPSC Code: 12352203
• NACRES: NA.46

Propiedades

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 1M7M9, monoclonal
• form: liquid
• mol wt: 114 kDa
• species reactivity: human, rat, rat
• concentration: 1.5 mg/mL
• technique(s): western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: AATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLK
• UniProt accession no.: Q9HCE1
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MOV10(4343)

Descripción

General description

5′ to 3′ RNA helicase contributing to UPF1 mRNA target degradation by translocation along 3′ UTRs. Required for microRNA (miRNA-mediated gene silencing by the RNA-induced silencing complex (RISC. Required for both miRNA-mediated translational repression and miRNA-mediated cleavage of complementary mRNAs by RISC. In cooperation with FMR1, regulates miRNA-mediated translational repression by AGO2. Restricts retrotransposition of long interspersed element-1 (LINE-1 in cooperation with TUT4 and TUT7 counteracting the RNA chaperonne activity of L1RE1. Facilitates LINE-1 uridylation by TUT4 and TUT7. Required for embryonic viability and for normal central nervous system development and function. Plays two critical roles in early brain development: suppresses retroelements in the nucleus by directly inhibiting cDNA synthesis, while regulates cytoskeletal mRNAs to influence neurite outgrowth in the cytosol (By similarity. May function as a messenger ribonucleoprotein (mRNP clearance factor. Exhibits antiviral activity against dengue virus (DENV.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 800-900 of human MOV10 (Q9HCE1).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1