SAB5702254

Anti-SST Antibody

rabbit monoclonal, 7Q4T0

• Sinónimos: SST,SMST
• UNSPSC Code: 12352203
• NACRES: NA.46

Propiedades

• Nombre del producto: Anti-Somatostatin (SST) Antibody, clone 7Q4T0, Rabbit Monoclonal,
• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 7Q4T0, monoclonal
• form: liquid
• species reactivity: mouse, rat
• concentration: 1 mg/mL
• technique(s): immunohistochemistry: 1:50 - 1:200
• color: colorless
• isotype: IgG
• immunogen sequence: TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
• UniProt accession no.: P61278
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SST(6750)

Descripción

General description

The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells.

Immunogen

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human Somatostatin (SST) (NP_001039.1).

Application

IHC

Información de seguridad

• pictograms: GHS07,GHS09
• signalword: Warning
• hcodes: H317,H411
• pcodes: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Hazard Classifications: Aquatic Chronic 2 - Skin Sens. 1
• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3