SAB2109178

Anti-SEMA3E (C-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: KIAA0331, M-SEMAH, M-SemaK, SEMAH, coll-5
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 86 kDa
• species reactivity (predicted by homology): rat, human, guinea pig, bovine, canine, horse, mouse, pig
• concentration: 0.5 mg/mL
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: NM_012431
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SEMA3E(57396)

Descripción

General description

Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and structural similarities, semaphorins are put into eight classes: invertebrates contain classes 1 and 2, viruses have class V, and vertebrates contain classes 3-7. Semaphorins serve as axon guidance ligands via multimeric receptor complexes, some (if not all) containing plexin proteins. This gene encodes a class 4 semaphorin. This gene encodes a class 3 semaphorin. Multiple transcript variants encoding different isoforms have been found for this gene.

Sequence

Synthetic peptide located within the following region: IENNSTLLECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVKMDLGLLFL

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable