SAB2108526

Anti-PPARGC1A

affinity isolated antibody

• Sinónimos: Anti- PGC-1, Anti- PGC-1v, Anti- Pgc-1alpha, Anti- Pgc1
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 90 kDa
• species reactivity: human, mouse
• concentration: 0.5-1 mg/mL
• technique(s): immunoblotting: suitable
• accession no.: NM_008904
• UniProt accession no.: O70343
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PPARGC1A(19017)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of mouse Ppargc1a

Biochem/physiol Actions

Ppargc1a is a transcriptional coactivator for steroid receptors and nuclear receptors. Ppargc1a greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Ppargc1a can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis.

Sequence

Synthetic peptide located within the following region: QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable