Saltar al contenido
MilliporeSigma
Todas las fotos(3)

Key Documents

SAB2108476

Sigma-Aldrich

Anti-MYC

affinity isolated antibody

Sinónimos:

Anti- MRTL, Anti- bHLHe39, Anti-c-Myc

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

50 kDa

species reactivity

guinea pig, mouse, rabbit, human, rat

concentration

0.5-1 mg/mL

technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

accession no.

NM_002467

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MYC(4609)

General description

The cellular myelocytomatosis (c-myc) gene mapped to human chromosome 8q24, is the cellular homologue of the v-myc gene originally isolated from an avian myelocytomatosis virus. c-myc is a member of MYC gene family. c-Myc gene codes for basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that regulates the G1-S cell cycle transition.

Immunogen

Synthetic peptide directed towards the N terminal region of human MYC

Biochem/physiol Actions

The cellular myelocytomatosis (c-myc) oncogene plays a vital role in cellular proliferation, differentiation, apoptosis and acts as transcriptional regulator of gene expression. c-Myc expression is essential and sufficient to assist most of the cells to enter synthetic (S) phase of the cell cycle. The encoded protein plays a crucial role in vasculogenesis and angiogenesis during cancer development and progression. c-Myc interacts with its binding partner Max and activates the transcription of growth promoting genes such as cyclin D2, ornithine decarboxylase and E2F1 and it also represses the transcription of multiple genes, especially p21 and p27, by binding to the transcription initiator element (Inr) in a complex with Max and either Sp1 or Miz1. Overexpression of MYC in DLBCL (diffuse large B-cell lymphoma) results in poor outcome and invasive treatment when medicated with rituximab plus cyclophosphamide, doxorubicin, vincristine and prednisone (R-CHOP).

Sequence

Synthetic peptide located within the following region: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Optional

Referencia del producto
Descripción
Precios

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Apoptotic signaling by c-MYC.
Hoffman B and Liebermann DA.
Oncogene, 27, 6462-6472 (2008)
8q24 prostate, breast, and colon cancer risk loci show tissue-specific long-range interaction with MYC.
Ahmadiyeh, Nasim, et al.
Proceedings of the National Academy of Sciences of the USA, 107, 9742-9746 (2010)
MAPK signal pathways in the regulation of cell proliferation in mammalian cells.
Zhang W and Liu HT.
Cell Research, 12, 9-18 (2002)
8q24 prostate, breast, and colon cancer risk loci show tissue-specific long-range interaction with MYC
Ahmadiyeh N, et al.
Proceedings of the National Academy of Sciences of the USA, 107, 9742-9746 (2010)
B Hoffman et al.
Oncogene, 27(50), 6462-6472 (2008-10-29)
c-MYC has a pivotal function in growth control, differentiation and apoptosis, and its abnormal expression is associated with many tumors. Overexpression of c-MYC sensitizes cells to apoptosis by a variety of stimuli. The decision of a cell to undergo apoptosis

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico