SAB2106245

Anti-PDX1 antibody produced in rabbit

affinity isolated antibody

• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 31 kDa
• species reactivity: rat, human, dog, rabbit, bovine, mouse, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_008814
• UniProt accession no.: P52946
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... PDX1(3651) ; mouse ... Pdx1(18609)

Descripción

Immunogen

The immunogen for anti-PDX1 antibody: synthetic peptide derected towards the N terminal of human PDX1

Biochem/physiol Actions

Pdx1 activates insulin and somatostatin gene transcription. It is a key regulator of islet peptide hormone expression but also responsible for the development of the pancreas, most probably by determining maturation and differentiation of common pancreatic precursor cells in the developing gut. It binds the DNA sequence 5′-CC[CT]TAATGGG-3′.

Sequence

Synthetic peptide located within the following region: LYMGRQPPPPPPPQFTSSLGSLEQGSPPDISPYEVPPLASDDPAGAHLHH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable