SAB2102766

Anti-ZFP36 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-G0S24, Anti-GOS24, Anti-NUP475, Anti-RNF162A, Anti-Zinc finger protein 36, C3H type, homolog (mouse)
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 34 kDa
• species reactivity: bovine, human, guinea pig, rabbit, dog, sheep
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• UniProt accession no.: P26651
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ZFP36(7538)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of human ZFP36

Biochem/physiol Actions

ZFP36 is a probable regulatory protein with a novel zinc finger structure involved in regulating the response to growth factors. Knockdown of ZFP36 increased both cognate macrophage gene mRNAs and inflammatory tumor necrosis factor protein release. Overexpression of ZFP36 resulted in decreased levels of the same genes supporting its role in regulating macrophage gene expression. Multiple phosphorylation sites in ZFP36 in mammalian cells were reported. ZFP36 can be phosphorylated by JNK as well as by the other members of the greater MAP kinase family. Gene expression profiling predicts clinical outcome of prostate cancer. Inappropriate ZFP36 production may be one factor that contributes to higher rheumatoid arthritis disease activity.

Sequence

Synthetic peptide located within the following region: PSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable