SAB1412592

ANTI-EGR1 antibody produced in mouse

clone 2H8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: AT225, EGR1, G0S30, KROX-24, NGFI-A
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2H8, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 37.84 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• NCBI accession no.: NM_001964
• UniProt accession no.: P18146
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... EGR1(1958)

Descripción

General description

The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. (provided by RefSeq)

Immunogen

EGR1 (NP_001955, 211 a.a. ~ 320 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSR*

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable