SAB1409172

Monoclonal Anti-RAX antibody produced in mouse

clone 3G8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: MCOP3, RX
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3G8, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 36.96 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_013435
• UniProt accession no.: Q9Y2V3
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RAX(30062)

Descripción

General description

Development of the vertebrate eye requires a series of steps including specification of the anterior neural plate, evagination of the optic vesicles from the ventral forebrain, and the cellular differentiation of the lens and retina. Homeobox-containing genes, including RAX, play a critical role in vertebrate and invertebrate eye formation (Mathers et al., 1997 [PubMed 9177348]).[supplied by OMIM

Immunogen

RAX (NP_038463, 104 a.a. ~ 206 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQD

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable