SAB1404899

Monoclonal Anti-ADAM29 antibody produced in mouse

clone 1F6, ascites fluid

• Sinónimos: svph1
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 1F6, monoclonal
• mol wt: antigen ~32.71 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgMκ
• NCBI accession no.: NM_014269
• UniProt accession no.: Q9UKF5
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ADAM29(11086)

Descripción

General description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is highly expressed in testis and may be involved in human spermatogenesis. Alternative splicing results in multiple transcript variants that encode the same protein. (provided by RefSeq)

Immunogen

ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK

Physical form

Clear solution

Información de seguridad

• Storage Class: 11 - Combustible Solids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable