Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Key Documents

HPA030976

Sigma-Aldrich

Anti-TRPM2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody

Sinónimos:

EREG1, KNP3, LTRPC2, NUDT9H, NUDT9L1, TRPC7

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL

immunogen sequence

IKKMLEVLVVKLPLSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TRPM2(7226)

General description

Transient receptor potential cation channel subfamily M member 2 (TRPM2) belongs to the TRPM subfamily and is majorly expressed in the brain especially in substantia nigra, hippocampus, striatum, and cortex. It comprises a C-terminal nudix hydrolase 9 (NUDT9) homology domain, a six-helix transmembrane (TM) domain, a rib helix, and a pole helix. The TRPM2 gene is mapped to human chromosome 21q22.3. Variants of TRPM2 are observed in neutrophil granulocytes.

Immunogen

transient receptor potential cation channel, subfamily M, member 2

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Transient receptor potential cation channel subfamily M member 2 (TRPM2) serves as a calcium-permeable cation channel. It is activated by nicotinamide adenine dinucleotide (NAD), ADP ribose, and by micro levels of hydrogen peroxide (H2O2). The C-terminal NUDT9 homology (NUDT9H) domain mediates adenosine monophosphate (AMP) and ribose-5-phosphate (R5P) synthesis from adenosine diphosphate (ADP)–ribose (ADPR). It is also permeable to sodium and potassium and activated by oxidant stress. TRPM2 via its calcium-signaling responses is involved in various immunological functions and neuroinflammation. It is also correlated to amyloid β (Aβ) generation as well as with the oxidative damage in the pathologies related to Alzheimer′s disease, and other diseases like multiple sclerosis and autism spectrum disorders.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST90730

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Takuji Uemura et al.
Biochemical and biophysical research communications, 328(4), 1232-1243 (2005-02-15)
Transient receptor potential melastatin 2 (TRPM2) is a calcium-permeable cation channel activated by ADP-ribose or reactive oxygen species. In human, a major transcript of 6.5 kb is expressed in various tissues, whereas a minor transcript of 5.5 kb is detected

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico