HPA017342

Anti-LPP antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-LIM domain-containing preferred translocation partner in lipoma, Anti-Lipoma-preferred partner
• MDL number: MFCD03097256
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA017342

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human, rat, mouse
• enhanced validation: independent; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• immunogen sequence: VVAPKPKYNPYKQPGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKST
• UniProt accession no.: Q93052
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... LPP(4026)

Descripción

General description

LPP (LIM domain containing preferred translocation partner in lipoma) is a member of group 3 of LIM (Lin11, Isl-1 & Mec-3) family of proteins. It is localized to human chromosome 3q28, has 10 exons, and spans around 400kb. It has an open reading frame of 1836bp, which codes for an 80kDa protein. Its N-terminal contains a leucine zipper motif, and it has three LIM domains at its C-terminal. It is expressed by the smooth muscle cells of stomach, portal vein, aorta, bladder, ileum, corpus cavernosum and uterus. Two alternatively spliced variants are exclusively expressed in testis.

Immunogen

Lipoma-preferred partner recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

LPP (LIM domain containing preferred translocation partner in lipoma) is involved in cell-cell adhesion and cell locomotion, as in the case of epithelial cells of small intestine. It might be involved in the pathogenesis of celiac disease. It interacts with protein-tyrosine-phosphatase 1B (PTP1B), and thus, might be involved in insulin signaling pathway. It is therefore, a candidate gene for polycystic ovary syndrome (PCOS). It is up-regulated in many human cancers such as, lung carcinoma, soft tissue sarcoma, and leukemia. It is a translocation partner of chromosome 12, in a subset of lipomas. LPP plays a role in cell proliferation and tumorigenesis. It amplifies the transactivational activity of PEA3 (polyoma enhancer activator 3), by acting as a co-regulatory protein at PEA3-dependent promoters.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72479

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)