HPA011038

Anti-NECTIN3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-CD113, Anti-CDw113, Anti-DKFZP566B0846, Anti-PPR3, Anti-PVRL3, Anti-PVRR3, Anti-nectin-3, Anti-CD113 antigen, Anti-Nectin-3, Anti-Poliovirus receptor-related protein 3 precursor
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA011038
• NACRES: NA.43

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• immunogen sequence: IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSF
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PVRL3(25945)

Descripción

General description

PVRL3 (poliovirus receptor-related 3) belongs to nectin family, which is a family of immunoglobulin-like molecules, and are involved in cell adhesion. This family contains four members namely, PVRL1, PVRL2, PVRL3 and PVRL4. These are ubiquitously expressed and have multiple isoforms due to alternative splicing. PVRL3 is also called nectin-3 and has three isoforms called nectin-3α, -3β and -3δ. These variants differ in their transmembrane and cytosolic domains, but have identical extracellular regions. This is the only nectin to be expressed by T-cells.

Immunogen

nectin cell adhesion molecule 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

PVRL3 (poliovirus receptor-related 3) is a cell-cell adhesion molecule. It forms trans-dimers with nectin-1, and also interacts with afadin to form cell-cell adhesions in non-epithelial cells, which lack tight junctions. PVRL3 present on lymphocytes interacts with nectin-2 expressed on vascular endothelial cells. This interaction is essential for leukocyte migration and extravasation. This is the first member of nectin family which plays a role in determining the ocular phenotype in humans, and is involved in the development of mammalian lens and ciliary body. Membranous expression of PVRL3 without E-cadherin co-localization in cancers, usually predicts poor prognosis and overall survival of patients. The expression of this protein is deregulated in breast cancer, and it might act as tumor suppressor and prevent metastasis in breast cancer cells.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72277

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)