HPA003396

Anti-ABCD4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-ATP-binding cassette sub-family D member 4 antibody produced in rabbit, Anti-P70R antibody produced in rabbit, Anti-PMP69 antibody produced in rabbit, Anti-PXMP1-L antibody produced in rabbit, Anti-Peroxisomal membrane protein 1-like antibody produced in rabbit, Anti-Peroxisomal membrane protein 69 antibody produced in rabbit
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA003396
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunohistochemistry: 1:200- 1:500
• immunogen sequence: TLVSKNAFVCIYLISCFTQLIDLSTTLSDVAGYTHRIGQLRETLLDMSLKSQDCEILGESEWGLDTPPGWPAAEPADTAFLLERVSISAPSSDKPLIKDLSLKISEGQSLLITGNTGTGK
• UniProt accession no.: O14678
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ABCD4(5826)

Descripción

Immunogen

ATP-binding cassette sub-family D member 4 recombinant protein epitope signature tag (PrEST)

Application

Anti-ABCD4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

ABCD4 (ATP-binding cassette, sub-family D (ALD), member 4) gene encodes an ATP-binding cassette (ABC) transporter that belongs to the ALD subfamily, the members of which participate in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. It is an ABC half transporter that requires a partner half transporter molecule in order to form a functional homodimeric or heterodimeric transporter. It contains a transmembrane domain and an ABC transporter or nucleotide-binding domain (NBD) that contains conserved motifs that can bind to ATP and Mg²⁺. The protein is localized to the endoplasmic reticulum and has a molar mass of 70kDa. The function of this transporter is unknown. It may play a role in the intracellular processing of cobalamin (vitamin B12). Mutations in this gene can cause an error in cobalamin metabolism.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70648

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)