Saltar al contenido
MilliporeSigma
Todas las fotos(4)

Documentos clave

AV38089

Sigma-Aldrich

Anti-E2F3 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-E2F transcription factor 3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

49 kDa

species reactivity

mouse, human, dog, guinea pig, rat, horse, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... E2F3(1871)

General description

E2F transcription factors are key regulators of cell growth, differentiation and cell death. E2F transcription factor 3 (E2F3) can be induced by DNA damage through transcriptional and posttranslational mechanisms wherein it functions as a master regulator of DNA damage response. E2F3, a transcriptional effector that commits cells to enter and progress through S phase, is uniquely amplified in specific human tumours, such as prostate cancer, where its expression is inversely correlated with the survival of patients.

Specificity

Anti-E2F3 polyclonal antibody reacts with canine, human, mouse, rat, and bovine E2F transcription factor 3 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human E2F3

Application

Anti-E2F3 polyclonal antibody is used to tag E2F transcription factor 3 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of E2F transcription factor 3 in the regulation of cell growth, differentiation and cell death and as an oncogene.

Biochem/physiol Actions

E2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.

Sequence

Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico