AV32331

Anti-EYA3 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Eyes absent homolog 3 (Drosophila)
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 63 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_001981
• UniProt accession no.: Q99504
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... EYA3(2140)

Descripción

General description

EYA3 interacts with Six1 and subsequently activates TSHβ expression in response to light changes in the photoperiodic system of mice. EYA3 expression has also been implicated in Ewing sarcoma.
Rabbit Anti-EYA3 antibody recognizes human, mouse, rat, and canine EYA3.

Immunogen

Synthetic peptide directed towards the middle region of human EYA3

Application

Rabbit Anti-EYA3 antibody can be used for IHC (4-8μg/ml) and western blot (0.05-1.0μg/ml) applications.

Biochem/physiol Actions

Eyes absent homolog 3 (EYA3) is a member of the eyes absent (EYA) family of proteins. This protein may act as a transcriptional activator and have a role during development. A similar protein in mice can act as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene.

Sequence

Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable