AV32263

Anti-ETV4 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Ets variant gene 4 (E1A enhancer binding protein, E1AF)
• UNSPSC Code: 12352203

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 54 kDa
• species reactivity: mouse, rat, human, pig, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001073143
• UniProt accession no.: P43268
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ETV4(2118)

Descripción

General description

ETS variant gene 4 (ETV4, E1AF) is a transcription factor that regulates cell motility and invasiveness. It confers an invasive (metastatic) phenotype on various cancer cells via activation of genes such involved in cell mobilization such as HER2/neu and various matrix metalloproteinases. ETV4/E1AR activates the Rho/Rho-associated kinase pathway.

Rabbit polyclonal anti-ETV4 antibody reacts with bovine, mouse, human, and rat ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factors.

Immunogen

Synthetic peptide directed towards the middle region of human ETV4

Application

Rabbit Anti-ETV4 antibody has been used for immunofluorescence applications at 1:200 dilution using formaldehyde-fixed cells. The antibody can also be used for western blot applications at 0.5μg/ml.

Rabbit polyclonal anti-ETV4 antibody is used to tag ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of ETS variant gene 4 (E1A enhancer binding protein, E1AF) transcription factor in cell mobilization and tumor metastasis/invasivness.

Biochem/physiol Actions

The protein encoded by the ETV4 gene is known to play a role in ovarian and breast malignancies as well as in the early stage of colorectal carcinogenesis.

Sequence

Synthetic peptide located within the following region: HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable