Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Key Documents

AV13019

Sigma-Aldrich

Anti-CHRNA9 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Cholinergic receptor, nicotinic, α-9 (muscle)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

55 kDa

species reactivity

guinea pig, horse, human, bovine, dog, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_060051

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CHRNA9(55584)

Immunogen

Synthetic peptide directed towards the N terminal region of human CHRNA9

Application

Anti-CHRNA9 antibody produced in rabbit is suitable for western blotting at a concentration of 0.0625 μg/ml.

Biochem/physiol Actions

CHRNA9 is a transmembrane oligomeric ligand-gated nicotinic receptor that induces ion channel opening for the movement of positive ions when it is activated by cholinergic binding. Nicotinic acetylcholine receptors mediate presynaptic, postsynaptic and extrasynaptic signaling. The expression of CHRNA9 receptor has been observed to be elevated in human breast epithelial cells during tumorigenesis. CHRNA9 has been implicated in stress-induced functional plasticity of rat adrenal medulla.

Sequence

Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Chia-Hwa Lee et al.
Journal of the National Cancer Institute, 102(17), 1322-1335 (2010-08-25)
Large epidemiological cohort studies in the United States have indicated that active and passive smoking are associated with increased breast cancer risk. However, there was no direct evidence of an effect of tobacco carcinogens on the cellular molecules involved in
Claude Colomer et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 30(19), 6732-6742 (2010-05-14)
An increase in circulating adrenal catecholamine levels constitutes one of the mechanisms whereby organisms cope with stress. Accordingly, stimulus-secretion coupling within the stressed adrenal medullary tissue undergoes persistent remodeling. In particular, cholinergic synaptic neurotransmission between splanchnic nerve terminals and chromaffin
Inmaculada Posadas et al.
Current neuropharmacology, 11(3), 298-314 (2013-11-02)
Many studies have focused on expanding our knowledge of the structure and diversity of peripheral and central nicotinic receptors. Nicotinic acetylcholine receptors (nAChRs) are members of the Cys-loop superfamily of pentameric ligand-gated ion channels, which include GABA (A and C)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico