SAB2109233

Anti-APBB1 (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonym(s): APBB1, FE65, RIR
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 78 kDa
• species reactivity (predicted by homology): human
• concentration: 0.5 mg/mL
• technique(s): western blot: 1 μg/mL
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... APBB1(57396)

Description

General description

The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimer′s disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene product′s nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimer′s disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human APBB1

Sequence

Synthetic peptide located within the following region: QALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDS

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable