Skip to Content
Merck
All Photos(3)

Key Documents

SAB1401724

Sigma-Aldrich

Monoclonal Anti-SSH1 antibody produced in mouse

clone 2F9, purified immunoglobulin, buffered aqueous solution

Synonym(s):

FLJ38102, KIAA1298, SSH-1

Sign Into View Organizational & Contract Pricing
All Photos(3)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2F9, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

capture ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

NM_018984

UniProt accession no.

Q8WYL5

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SSH1(54434)

General description

The ADF (actin-depolymerizing factor)/cofilin family (see MIM 601442) is composed of stimulus-responsive mediators of actin dynamics. ADF/cofilin proteins are inactivated by kinases such as LIM domain kinase-1 (LIMK1; MIM 601329). The SSH family appears to play a role in actin dynamics by reactivating ADF/cofilin proteins in vivo (Niwa et al., 2002 [PubMed 11832213]).[supplied by OMIM

Immunogen

SSH1 (NP_061857.2, 752 a.a. ~ 849 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPAS

Application

Monoclonal Anti-SSH1 antibody produced in mouse is suitable for capture ELISA and western blot assay.

Biochem/physiol Actions

SSH1 (Slingshot protein phosphatase 1) is mainly involved in the actin filament organization. During cytokinesis, it reactivates ADF (actin-depolymerizing factor)/cofilin, which plays a major role in actin filament dynamics and cell migration. Apart from cofilin reactivation, it also dephosphorylates P-cofilin in vitro and in vivo. Overexpression of SSH1 has been reported in pancreatic cancer (PC) cells, which indicates its role in tumor cell migration via SSH1L/cofilin-1 signal pathway.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ryusuke Niwa et al.
Cell, 108(2), 233-246 (2002-02-08)
The ADF (actin-depolymerizing factor)/cofilin family is a stimulus-responsive mediator of actin dynamics. In contrast to the mechanisms of inactivation of ADF/cofilin by kinases such as LIM-kinase 1 (LIMK1), much less is known about its reactivation through dephosphorylation. Here we report
Noriko Kaji et al.
The Journal of biological chemistry, 278(35), 33450-33455 (2003-06-17)
During cytokinesis the actomyosin-based contractile ring is formed at the equator, constricted, and then disassembled prior to cell abscission. Cofilin stimulates actin filament disassembly and is implicated in the regulation of contractile ring dynamics. However, little is known about the
Yufeng Wang et al.
Cancer letters, 360(2), 171-176 (2015-02-17)
Slingshot-1L (SSH1L), a cofilin-phosphatase, plays a role in actin dynamics and cell migration by reactivating cofilin-1. However, the expression of SSH1L in malignant diseases is poorly understood. The overexpression of SSH1L in cancerous tissue compared to the matched surrounding non-cancerous

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service