Saltar al contenido
Merck
Todas las fotos(7)

Documentos clave

WH0000308M1

Sigma-Aldrich

Monoclonal Anti-ANXA5 antibody produced in mouse

clone 1F4-1A5, purified immunoglobulin, buffered aqueous solution

Sinónimos:

ANX5, ENX2, PP4, annexin A5

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1F4-1A5, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ANXA5(308)

General description

The annexin A5 (ANXA5) gene is mapped to human chromosome 4q26-q28 and spans a length of 28kb containing 13 exons and 12 introns. ANXA5 is a member of the annexin family of calcium and membrane-binding proteins that have anti-coagulatory and anti-inflammatory properties. The encoded protein is 320 amino acid long and is folded into four domains, each having five α-helices, forming a superhelical globular structure.
The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. (provided by RefSeq)

Immunogen

ANXA5 (AAH01429, 1 a.a. ~ 320 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Application

The annexin A5 (ANXA5) gene is mapped to human chromosome 4q26-q28 and spans a length of 28kb containing 13 exons and 12 introns. ANXA5 is a member of the annexin family of calcium and membrane-binding proteins that have anti-coagulatory and anti-inflammatory properties. The encoded protein is 320 amino acid long and is folded into four domains, each having five α-helices, forming a superhelical globular structure.

Biochem/physiol Actions

Annexins are a family of water-soluble proteins that bind to membranes and phospholipids in a calcium-dependent manner. They participate in several cellular functions, such as membrane fusion and cytoskeletal interaction. ANXA5 is a potent anticoagulant and serves as a voltage-gated calcium channel when bound to membrane in vitro. It is found to inhibit phospholipase A2 and protein kinase C.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

2D-DIGE to identify proteins associated with gestational diabetes in omental adipose tissue
Oliva K
The Journal of Endocrinology, 218, 165-178 (2013)
The crystal and molecular structure of human annexin V, an anticoagulant protein that binds to calcium and membranes.
Huber R
The Embo Journal, 9, 3867-3874 (1990)
Crystal and molecular structure of human annexin V after refinement. Implications for structure, membrane binding and ion channel formation of the annexin family of proteins.
Huber R
Journal of Molecular Biology, 223, 683-704 (1992)
Organization of the human annexin V (ANX5) gene.
Cookson BT
Genomics, 20, 463-467 (1994)
Liwen Song et al.
Vaccine, 32(46), 6039-6048 (2014-09-24)
Immunotherapy has emerged as a promising approach that can be used in conjunction with conventional chemotherapy and radiotherapy to further improve the survival rate of patients with advanced cancer. We have recently shown in previous studies that chemotherapy and radiation

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico