AV44701

Anti-MGAT2 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-CDGS2, Anti-GLCNACTII, Anti-GNT-II, Anti-GNT2, Anti-Mannosyl (α-1,6-)-glycoprotein β-1,2-N-acetylglucosaminyltransferase
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 51 kDa
• species reactivity: rat, mouse, human, rabbit, horse, dog, bovine, guinea pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_002399
• UniProt accession no.: Q10469
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MGAT2(4247)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of human MGAT2

Application

Anti-MGAT2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biochem/physiol Actions

Mannosyl (α-1,6-)-glycoprotein β-1,2-N-acetylglucosaminyltransferase (MGAT2) is a Golgi enzyme highly expressed in small intestine of mice and humans. It is a key regulator of fat metabolism and energy expenditure. Mutations in this gene show resistance to metabolic disorders induced by high-fat feeding and exhibit increased energy expenditure.

Sequence

Synthetic peptide located within the following region: PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable