WH0055802M6
Monoclonal Anti-DCP1A antibody produced in mouse
clone 3G4, purified immunoglobulin, buffered aqueous solution
동의어(들):
Anti-DCP1 decapping enzyme homolog A (S. cerevisiae), Anti-HSA275986, Anti-Nbla00360, Anti-SMAD4IP1, Anti-SMIF
로그인조직 및 계약 가격 보기
모든 사진(3)
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
추천 제품
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
3G4, monoclonal
양식
buffered aqueous solution
종 반응성
human, mouse, rat
기술
ELISA: suitable
capture ELISA: suitable
immunofluorescence: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... DCP1A(55802)
관련 카테고리
일반 설명
Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. (provided by RefSeq)
면역원
DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Sequence
STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
관련 제품
제품 번호
설명
가격
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Tzu-Wei Chuang et al.
The Journal of biological chemistry, 291(16), 8565-8574 (2016-02-19)
Eukaryotic mRNA biogenesis involves a series of interconnected steps mediated by RNA-binding proteins. The exon junction complex core protein Y14 is required for nonsense-mediated mRNA decay (NMD) and promotes translation. Moreover, Y14 binds the cap structure of mRNAs and inhibits
Juan F Correa-Vázquez et al.
Cell death & disease, 12(4), 305-305 (2021-03-24)
Post-translational modification by covalent attachment of the Small ubiquitin-like modifier (Sumo) polypeptide regulates a multitude of processes in vertebrates. Despite demonstrated roles of Sumo in the development and function of the nervous system, the identification of key factors displaying a
Yukihiro Yabuta et al.
The Journal of cell biology, 192(5), 781-795 (2011-03-09)
The Tudor domain-containing proteins (TDRDs) are an evolutionarily conserved family of proteins involved in germ cell development. We show here that in mice, TDRD5 is a novel component of the intermitochondrial cements (IMCs) and the chromatoid bodies (CBs), which are
Manas Ranjan Sahoo et al.
EMBO reports, 18(2), 241-263 (2017-01-01)
MicroRNA (miRNA)-guided mRNA repression, mediated by the miRNA-induced silencing complex (miRISC), is an important component of post-transcriptional gene silencing. However, how miRISC identifies the target mRNA in vivo is not well understood. Here, we show that the nucleoporin Nup358 plays
Xiao Wang et al.
Nature, 505(7481), 117-120 (2013-11-29)
N(6)-methyladenosine (m(6)A) is the most prevalent internal (non-cap) modification present in the messenger RNA of all higher eukaryotes. Although essential to cell viability and development, the exact role of m(6)A modification remains to be determined. The recent discovery of two
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.