추천 제품
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
4G7, monoclonal
형태
buffered aqueous solution
종 반응성
rat, mouse, human
기술
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SCN8A(6334)
일반 설명
Sodium voltage-gated channel αsubunit 8 (SCN8A) is expressed in the central nervous system. The protein is specifically expressed in the axonal initial segment (AIS) and the nodes of Ranvier of myelinated axons. The gene encoding SCN8A is localized on human chromosome 12q13.13.
면역원
SCN8A (NP_055006, 1854 a.a. ~ 1951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT
Sequence
RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT
생화학적/생리학적 작용
Sodium voltage-gated channel αsubunit 8 (SCN8A) has a role in the generation and conduction of action potential. Mutations in the SCN8A gene have been associated with early infantile epileptic encephalopathy type 13.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Sodium channel SCN8A (Nav1.6): properties and de novo mutations in epileptic encephalopathy and intellectual disability.
O'Brien JE and Meisler MH
Frontiers in Genetics (2013)
SCN8A mutations in Chinese patients with early onset epileptic encephalopathy and benign infantile seizures.
Wang J
BMC Medical Genetics, 18(1), 104-104 (2017)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.