WH0005110M2

Monoclonal Anti-PCMT1 antibody produced in mouse

clone 1D6, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-protein-L-isoaspartate (D-aspartate) O-methyltransferase
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1D6, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: mouse, rat, human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: NM_005389
• UniProt 수납 번호: P22061
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PCMT1(5110)

설명

일반 설명

Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.[supplied by OMIM

면역원

PCMT1 (NP_005380, 117 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSR

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)