WH0004222M1

Monoclonal Anti-MEOX1 antibody produced in mouse

clone 1A10, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-MOX1, Anti-mesenchyme homeobox 1
• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1A10, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: NM_004527
• UniProt 수납 번호: P50221
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MEOX1(4222)

설명

일반 설명

MEOX1 (mesenchyme homeobox 1) gene codes for homeobox proteins that are located on many mesodermal structures. It has an N terminal, middle, a C terminal domain, as well as a homeo domain. This gene is located on human chromosome 17q21.31.

This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. (provided by RefSeq)

면역원

MEOX1 (NP_004518.1, 165 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS

생화학적/생리학적 작용

MEOX1 (mesenchyme homeobox 1) is essential in axial skeleton and limb muscle development. Mutation in MEOX1 gene results in Klippel-feil syndrome subtype.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)