추천 제품
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
2B10, monoclonal
형태
buffered aqueous solution
종 반응성
rat, mouse, human
기술
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... DHFR(1719)
일반 설명
Dihydrofolate reductase (DHFR) is encoded by the gene mapped to human chromosome 5q14. The encoded protein belongs to reductase family of enzymes. It is ubiquitously expressed in all organisms. DHFR is characterized with an α/β fold with a central 8-stranded sheet, flanked by four α helices.
Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. (provided by RefSeq)
면역원
DHFR (AAH03584, 88 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
Sequence
HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
생화학적/생리학적 작용
Dihydrofolate reductase (DHFR) is a folate-metabolizing enzyme that catalyzes nicotinamide adenine dinucleotide phosphate (NADPH)-dependent reduction of dihydrofolate (DHF) to tetrahydrofolate (THF), as well as folic acid to DHF. The encoded protein is implicated in regulation of intracellular folate homeostasis and it acts as a key target for cytostatic drugs. Genetic variations in the gene is associated with the development of various neurologic diseases.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Dihydrofolate Reductase Deficiency Due to a Homozygous DHFR Mutation Causes Megaloblastic Anemia and Cerebral Folate Deficiency Leading to Severe Neurologic Disease
Cario H, et al.
American Journal of Human Genetics, 88, 226-231 (2011)
A Genomewide Exploration Suggests a New Candidate Gene at Chromosome 11q23 as the Major Determinant of Plasma Homocysteine Levels: Results from the GAIT Project
Souto JC, et al.
American Journal of Human Genetics, 76, 925-933 (2005)
Rare De Novo Copy Number Variants in Patients with Congenital Pulmonary Atresia
Xie L, et al.
PLoS ONE, 9 (2014)
Dihydrofolate Reductase Gene Variations in Susceptibility to Disease and Treatment Outcomes
Askari BS and Krajinovic M
Current Genomics, 11, 578-583 (2010)
Sharon Spizzichino et al.
The FEBS journal, 289(6), 1625-1649 (2021-10-26)
De novo thymidylate synthesis is a crucial pathway for normal and cancer cells. Deoxythymidine monophosphate (dTMP) is synthesized by the combined action of three enzymes: serine hydroxymethyltransferase (SHMT1), dihydrofolate reductase (DHFR) and thymidylate synthase (TYMS), with the latter two being targets
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.