콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

WH0000142M1

Sigma-Aldrich

Monoclonal Anti-PARP1 antibody produced in mouse

clone 3G4, purified immunoglobulin, buffered aqueous solution

동의어(들):

PARP1 Antibody - Monoclonal Anti-PARP1 antibody produced in mouse, Parp1 Antibody, Anti-ADPRT, Anti-ADPRT1, Anti-PARP, Anti-PARP1, Anti-PPOL, Anti-pADPRT1, Anti-poly (ADP-ribose) polymerase family, member 1

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

3G4, monoclonal

양식

buffered aqueous solution

종 반응성

human

기술

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

동형

IgG2aκ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PARP1(142)

일반 설명

Poly (ADP-ribose) polymerase 1 (PARP1) is a nuclear protein and belongs to the PARP family. This protein is made up of the N-terminal DNA-binding domain, central auto modification domain and C-terminal catalytic domain. PARP1 protein is located on the nucleoli. The PARP1 gene is located on the human chromosome at 1q42.12.

면역원

PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD

애플리케이션

Monoclonal Anti-PARP1 antibody produced in mouse has been used in:
  • western blotting
  • indirect immunofluorescence
  • high-throughput cellular thermal shift assay (CESTA HT)

생화학적/생리학적 작용

Poly (ADP-ribose) polymerase 1 (PARP1) protein plays a role in DNA repair by catalyzing the polymerization of adenosine diphosphate (ADP)-ribose units. This protein also plays a role in the early response to DNA damage. Mutations in the PARP1 gene is associated with loss of cell viability.

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Yingbiao Ji et al.
Current opinion in genetics & development, 20(5), 512-518 (2010-07-02)
Cell growth and differentiation during developmental processes require the activation of many inducible genes. However, eukaryotic chromatin, which consists of DNA and histones, becomes a natural barrier impeding access to the functional transcription machinery. To break through the chromatin barrier
Joseph Shaw et al.
SLAS discovery : advancing life sciences R & D, 24(2), 121-132 (2018-12-14)
Methods to measure cellular target engagement are increasingly being used in early drug discovery. The Cellular Thermal Shift Assay (CETSA) is one such method. CETSA can investigate target engagement by measuring changes in protein thermal stability upon compound binding within
Todd A Hopkins et al.
Molecular cancer research : MCR, 17(2), 409-419 (2018-11-16)
PARP inhibitors have recently been approved as monotherapies for the treatment of recurrent ovarian cancer and metastatic BRCA-associated breast cancer, and ongoing studies are exploring additional indications and combinations with other agents. PARP inhibitors trap PARP onto damaged chromatin when
Bong-Gun Ju et al.
Cell, 119(6), 815-829 (2004-12-21)
Switching specific patterns of gene repression and activation in response to precise temporal/spatial signals is critical for normal development. Here we report a pathway in which induction of CaMKIIdelta triggers an unexpected switch in the function of the HES1 transcription
Carolina Velazquez et al.
Frontiers in oncology, 13, 1125021-1125021 (2023-04-04)
About 15% of Triple-Negative-Breast-Cancer (TNBC) present silencing of the BRCA1 promoter methylation and are assumed to be Homologous Recombination Deficient (HRD). BRCA1-methylated (BRCA1-Me) TNBC could, thus, be eligible to treatment based on PARP-inhibitors or Platinum salts. However, their actual HRD

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.