SAB5702558

Anti-14-3-3 epsilon Antibody, clone 4X6E1, Rabbit Monoclonal

• 동의어(들): 14-3-3E, HEL2, KCIP-1, MDCR, MDS
• UNSPSC 코드: 12352203
• NACRES: NA.46
• 클론: 4X6E1, monoclonal
• application: WB
• 종 반응성: human, rat, rat
• 기술: western blot: 1:500 - 1:2000

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 4X6E1, monoclonal
• 양식: liquid
• 분자량: 28 kDa
• 종 반응성: human, rat, rat
• 농도: 0.2 mg/mL
• 기술: western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDI
• UniProt 수납 번호: P62258
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... YWHAE(7531)

설명

일반 설명

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene. [provided by RefSeq, Aug 2008]

면역원

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 epsilon (P62258).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1