SAB5702430

Anti-AKR1C3 Antibody, clone 7T10F5, Rabbit Monoclonal

• 동의어(들): DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, PGFS, hluPGFS
• UNSPSC 코드: 12352203
• NACRES: NA.46
• 클론: 7T10F5, monoclonal
• application: IF; WB
• 종 반응성: mouse, mouse
• 기술: immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 7T10F5, monoclonal
• 양식: liquid
• 분자량: 37 kDa
• 종 반응성: mouse, mouse
• 농도: 0.335 mg/mL
• 기술: immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: SKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
• UniProt 수납 번호: P42330
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... AKR1C3(8644)

설명

일반 설명

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

면역원

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human AKR1C3 (P42330).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB, IF/ICC

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1