SAB5702265

[KO Validated]Anti-AKT1 Antibody, clone 0O8L9, Rabbit Monoclonal

• 동의어(들): AKT,CWS6,PKB,PKB-ALPHA,PRKBA,RAC,RAC-ALPHA,AKT1
• UNSPSC 코드: 12352203
• NACRES: NA.46
• 클론: 0O8L9, monoclonal
• application: WB
• 종 반응성: rat, rat, human
• 기술: western blot: 1:500 - 1:1000

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 0O8L9, monoclonal
• 양식: liquid
• 분자량: 60 kDa
• 종 반응성: rat, rat, human
• 농도: 1 mg/mL
• 기술: western blot: 1:500 - 1:1000
• 색상: colorless
• 동형: IgG
• 면역원 서열: SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
• UniProt 수납 번호: P31749
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... AKT1(207)

설명

일반 설명

The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Mutations in this gene have been associated with the Proteus syndrome. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2011]

면역원

A synthetic peptide corresponding to a sequence within amino acids 381-480 of human AKT1 (NP_005154.2).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB

안전성 정보

• 픽토그램: GHS07,GHS09
• 신호어: Warning
• 유해 및 위험 성명서: H317,H411
• 예방조치 성명서: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Hazard Classifications: Aquatic Chronic 2 - Skin Sens. 1
• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3